PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000587.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 306aa    MW: 34649.1 Da    PI: 7.1126
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000587.1_g00010.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.5e-5551311129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhP+deel+++yL +kv++ ++++ ++i++vd++k+ePwdLp k++ +ek+wyfFs +d+ky+tg r+nrat++gyWk+t
  Itr_sc000587.1_g00010.1   5 LPPGFRFHPSDEELITYYLSNKVSDFTFTA-KAIADVDLNKCEPWDLPGKASMGEKQWYFFSLKDRKYPTGLRTNRATEAGYWKTT 89 
                              79*************************999.88***************988999******************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke+++ +g lvg+kktLvfy+grapkg kt+Wvmheyrle
  Itr_sc000587.1_g00010.1  90 GKDKEIFC-GGVLVGMKKTLVFYRGRAPKGLKTNWVMHEYRLE 131
                              ********.********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-634151IPR003441NAC domain
PROSITE profilePS5100559.5315151IPR003441NAC domain
PfamPF023657.1E-286130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MEGNLPPGFR FHPSDEELIT YYLSNKVSDF TFTAKAIADV DLNKCEPWDL PGKASMGEKQ  60
WYFFSLKDRK YPTGLRTNRA TEAGYWKTTG KDKEIFCGGV LVGMKKTLVF YRGRAPKGLK  120
TNWVMHEYRL ENKHGFKPAK EEWIVCRVFE KSSTAKKPQA TSSSPQSPES PCDTTTFASE  180
LEDISDPPNL SWQNNYFNTP NPITTLPLLP WPPSLLTPTT NLSSVNSMLF RALQLRANQA  240
PIATTFGYSH TPQGTENHHL LTQFENDFIP SNNFAVTTAS SSMVLDSVNQ QEPPMEQPYR  300
LDSNIW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-56415719174NAC domain-containing protein 19
3swp_C1e-56415719174NAC domain-containing protein 19
3swp_B1e-56415719174NAC domain-containing protein 19
3swp_A1e-56415719174NAC domain-containing protein 19
3swm_D1e-56415719174NAC domain-containing protein 19
3swm_C1e-56415719174NAC domain-containing protein 19
3swm_B1e-56415719174NAC domain-containing protein 19
3swm_A1e-56415719174NAC domain-containing protein 19
4dul_B1e-56415716171NAC domain-containing protein 19
4dul_A1e-56415716171NAC domain-containing protein 19
1ut7_B1e-56415716171NO APICAL MERISTEM PROTEIN
1ut7_A1e-56415716171NO APICAL MERISTEM PROTEIN
1ut4_B1e-56415716171NO APICAL MERISTEM PROTEIN
1ut4_A1e-56415716171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096994.11e-130PREDICTED: protein CUP-SHAPED COTYLEDON 1
SwissprotQ9FLJ21e-81NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A068TSV31e-124A0A068TSV3_COFCA; Uncharacterized protein
STRINGPOPTR_0015s03700.11e-120(Populus trichocarpa)
STRINGGLYMA07G10240.11e-120(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-101NAC domain containing protein 58